PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G122897_P01
Common NameHDZIV8_OCL8, ZEAMMB73_395029, Zm.37420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family HD-ZIP
Protein Properties Length: 742aa    MW: 79524.9 Da    PI: 5.2591
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G122897_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.85.7e-2145101157
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                        +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  GRMZM2G122897_P01  45 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 101
                        688999************************************************995 PP

2START200.29e-632504741206
                        HHHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS..........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
              START   1 elaeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.........dsgealrasgvvdmvlallveellddkeqWdet 75 
                        ela +a++elv++a+++ep+W   +        e +n++e+ + f               ++ea+r+s+vv+m++a+lve+l+d++ q+   
  GRMZM2G122897_P01 250 ELAVAAMEELVRMAQLDEPLWNAPAgldgsaeeETLNEEEYARLF----PgglgpkpygLNSEASRDSAVVIMTHANLVEILMDVN-QYAAV 336
                        57899******************99**666665566666666666....04457********************************.66666 PP

                        -S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEE CS
              START  76 la....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliep 156
                        +     +a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q  +g+w++vdvS+d  ++      v +++++pSg+li++
  GRMZM2G122897_P01 337 FSsivsRAATLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNADGTWAVVDVSLDGLRPGA----VLKCRRRPSGCLIQE 424
                        655555*****************************************************************98....8************** PP

                        ECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 157 ksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                        ++ng+skvtwvehv++++r++h++++ lv+sgla+ga++wv tl+rqce+
  GRMZM2G122897_P01 425 MPNGYSKVTWVEHVEVDDRSVHSIYKLLVSSGLAFGARRWVGTLDRQCER 474
                        ************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-2323100IPR009057Homeodomain-like
SuperFamilySSF466893.22E-2028102IPR009057Homeodomain-like
PROSITE profilePS5007117.21642102IPR001356Homeobox domain
SMARTSM003891.9E-2043106IPR001356Homeobox domain
PfamPF000461.4E-1845100IPR001356Homeobox domain
CDDcd000864.18E-2045103No hitNo description
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PROSITE profilePS5084841.241241477IPR002913START domain
SuperFamilySSF559611.92E-34242476No hitNo description
CDDcd088754.01E-115245473No hitNo description
SMARTSM002345.3E-58250474IPR002913START domain
PfamPF018528.8E-53251474IPR002913START domain
Gene3DG3DSA:3.30.530.205.7E-5314443IPR023393START-like domain
SuperFamilySSF559611.81E-23495729No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006354anatomyear floret
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009009anatomyplant embryo
PO:0009025anatomyvascular leaf
PO:0009054anatomyinflorescence bract
PO:0009066anatomyanther
PO:0009074anatomystyle
PO:0009084anatomypericarp
PO:0009089anatomyendosperm
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020127anatomyprimary root
PO:0020136anatomyear inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025142anatomyleaf tip
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001095developmental stageplant embryo true leaf formation stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007003developmental stageIL.03 full inflorescence length reached stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007015developmental stageradicle emergence stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007022developmental stageseed imbibition stage
PO:0007026developmental stageFL.00 first flower(s) open stage
PO:0007031developmental stagemid whole plant fruit ripening stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007112developmental stage1 main shoot growth stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 742 aa     Download sequence    Send to blast
MGRGGGGVSD PLLGDEFESK SGSENVDGGV SVDELQDPNQ RPSKKKRYHR HTQHQIQELE  60
AFFKECPHPD DKQRKELSRE LGLEPLQVKF WFQNKRTQMK NHHERQENSQ LRSENEKLRA  120
ENMRYKEALS SASCPSCGGP AALGEMSFDE HHLRVENARL REEVDRISSI AAKYVGRPMV  180
PFPVLSSPLA GAGARAPALP PLDMAPPYGA AADMFGGGGV VAAAGAAGAG DLLLRGAAVQ  240
SDADKPMIVE LAVAAMEELV RMAQLDEPLW NAPAGLDGSA EEETLNEEEY ARLFPGGLGP  300
KPYGLNSEAS RDSAVVIMTH ANLVEILMDV NQYAAVFSSI VSRAATLEVL STGVAGNYNG  360
ALQVMSVEFQ VPSPLVPTRE SYFVRYCKQN ADGTWAVVDV SLDGLRPGAV LKCRRRPSGC  420
LIQEMPNGYS KVTWVEHVEV DDRSVHSIYK LLVSSGLAFG ARRWVGTLDR QCERLASVMA  480
SNIPTSDIGV ITSAEGRKSM LKLAERMVMS FCGGVTASAA HQWTTLSGSG AEDVRVMTRK  540
SVDDPGRPPG IVLNAATSFW LPVPPKRVFD FLRDESSRSE WDILSNGGVV QEMAHIANGR  600
DHGNCVSLLR VNSTNSNQSS MLILQESCTD MSGSYVIYAP VDVVAMNVVL NGGDPDYVAL  660
LPSGFAILPD GPSSGSSSML QGDGGVGSGG SLLTVAFQIL VDSVPTAKIS LGSVATVNSL  720
IACTVERIKA AVISGQSNPQ QQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.374200.0ear| meristem| ovary| shoot
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G122897
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G122897_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672590.0BT067259.1 Zea mays full-length cDNA clone ZM_BFb0357I11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008662199.10.0PREDICTED: uncharacterized protein LOC100383453 isoform X3
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLG2J5S20.0G2J5S2_MAIZE; Homeodomain leucine zipper family IV protein
STRINGGRMZM2G122897_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2
Publications ? help Back to Top
  1. Javelle M, et al.
    Genome-wide characterization of the HD-ZIP IV transcription factor family in maize: preferential expression in the epidermis.
    Plant Physiol., 2011. 157(2): p. 790-803
    [PMID:21825105]